Class g: Small proteins [56992] (66 folds) |
Fold g.41: Rubredoxin-like [57769] (12 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
Superfamily g.41.5: Rubredoxin-like [57802] (3 families) |
Family g.41.5.1: Rubredoxin [57803] (2 proteins) |
Protein Rubrerythrin, C-terminal domain [57811] (1 species) |
Species Desulfovibrio vulgaris [TaxId:881] [57812] (7 PDB entries) |
Domain d1ryt_2: 1ryt 148-191 [45245] Other proteins in same PDB: d1ryt_1 complexed with fe |
PDB Entry: 1ryt (more details), 2.1 Å
SCOP Domain Sequences for d1ryt_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ryt_2 g.41.5.1 (148-191) Rubrerythrin, C-terminal domain {Desulfovibrio vulgaris} flreqatkwrcrncgyvhegtgapelcpacahpkahfellginw
Timeline for d1ryt_2: