SCOP 1.57: Domain d1ryt_2: 1ryt 148-191

Lineage for d1ryt_2 (1ryt 148-191)

1. Root: SCOP 1.57

2. Class g: Small proteins [56992] (56 folds)

3. Fold g.41: Rubredoxin-like [57769] (9 superfamilies)

4. Superfamily g.41.5: Rubredoxin-like [57802] (3 families)

5. Family g.41.5.1: Rubredoxin [57803] (2 proteins)

6. Protein Rubrerythrin, C-terminal domain [57811] (1 species)

7. Species Desulfovibrio vulgaris [TaxId:881] [57812] (3 PDB entries)

8. Domain d1ryt_2: 1ryt 148-191 [45245]
   Other proteins in same PDB: d1ryt_1

Details for d1ryt_2

PDB Entry: 1ryt, 2.1 Å

PDB Description: rubrerythrin

SCOP Domain Sequences for d1ryt_2:

Sequence; same for both SEQRES and ATOM records:

>d1ryt_2 g.41.5.1 (148-191) Rubrerythrin, C-terminal domain {Desulfovibrio vulgaris}
flreqatkwrcrncgyvhegtgapelcpacahpkahfellginw

Timeline for d1ryt_2:

• d1ryt_2 first appeared (with stable ids) in SCOP 1.55
  
• d1ryt_2 appears in SCOP 1.59
  
• d1ryt_2 appears in the current release, SCOPe 2.08, called d1ryta2