Lineage for d1dx8a_ (1dx8 A:)

  1. Root: SCOPe 2.02
  2. 1239924Class g: Small proteins [56992] (90 folds)
  3. 1244855Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 1245023Superfamily g.41.5: Rubredoxin-like [57802] (3 families) (S)
  5. 1245024Family g.41.5.1: Rubredoxin [57803] (5 proteins)
  6. 1245033Protein Rubredoxin [57804] (8 species)
  7. 1245081Species Guillardia theta [TaxId:55529] [57810] (2 PDB entries)
  8. 1245083Domain d1dx8a_: 1dx8 A: [45243]
    complexed with zn

Details for d1dx8a_

PDB Entry: 1dx8 (more details)

PDB Description: rubredoxin from guillardia theta
PDB Compounds: (A:) rubredoxin

SCOPe Domain Sequences for d1dx8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dx8a_ g.41.5.1 (A:) Rubredoxin {Guillardia theta [TaxId: 55529]}
meidegkyeceacgyiyepekgdkfagippgtpfvdlsdsfmcpacrspknqfksikkvi
agfaenqkyg

SCOPe Domain Coordinates for d1dx8a_:

Click to download the PDB-style file with coordinates for d1dx8a_.
(The format of our PDB-style files is described here.)

Timeline for d1dx8a_: