Lineage for d1dx8a_ (1dx8 A:)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 41508Fold g.41: Rubredoxin-like [57769] (8 superfamilies)
  4. 41580Superfamily g.41.5: Rubredoxin-like [57802] (3 families) (S)
  5. 41581Family g.41.5.1: Rubredoxin [57803] (2 proteins)
  6. 41582Protein Rubredoxin [57804] (6 species)
  7. 41609Species Guillardia theta [TaxId:55529] [57810] (1 PDB entry)
  8. 41610Domain d1dx8a_: 1dx8 A: [45243]

Details for d1dx8a_

PDB Entry: 1dx8 (more details)

PDB Description: rubredoxin from guillardia theta

SCOP Domain Sequences for d1dx8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dx8a_ g.41.5.1 (A:) Rubredoxin {Guillardia theta}
meidegkyeceacgyiyepekgdkfagippgtpfvdlsdsfmcpacrspknqfksikkvi
agfaenqkyg

SCOP Domain Coordinates for d1dx8a_:

Click to download the PDB-style file with coordinates for d1dx8a_.
(The format of our PDB-style files is described here.)

Timeline for d1dx8a_: