Lineage for d1caaa_ (1caa A:)

  1. Root: SCOPe 2.02
  2. 1239924Class g: Small proteins [56992] (90 folds)
  3. 1244855Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 1245023Superfamily g.41.5: Rubredoxin-like [57802] (3 families) (S)
  5. 1245024Family g.41.5.1: Rubredoxin [57803] (5 proteins)
  6. 1245033Protein Rubredoxin [57804] (8 species)
  7. 1245093Species Pyrococcus furiosus [TaxId:2261] [57809] (24 PDB entries)
    Uniprot P24297
  8. 1245119Domain d1caaa_: 1caa A: [45239]
    complexed with fe

Details for d1caaa_

PDB Entry: 1caa (more details), 1.8 Å

PDB Description: x-ray crystal structures of the oxidized and reduced forms of the rubredoxin from the marine hyperthermophilic archaebacterium pyrococcus furiosus
PDB Compounds: (A:) rubredoxin

SCOPe Domain Sequences for d1caaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1caaa_ g.41.5.1 (A:) Rubredoxin {Pyrococcus furiosus [TaxId: 2261]}
akwvckicgyiydedagdpdngispgtkfeelpddwvcpicgapksefekled

SCOPe Domain Coordinates for d1caaa_:

Click to download the PDB-style file with coordinates for d1caaa_.
(The format of our PDB-style files is described here.)

Timeline for d1caaa_: