Lineage for d1caaa_ (1caa A:)

  1. Root: SCOPe 2.08
  2. Class g: Small proteins [56992] (100 folds)
  3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. Superfamily g.41.5: Rubredoxin-like [57802] (4 families) (S)
  5. Family g.41.5.1: Rubredoxin [57803] (5 proteins)
  6. Protein Rubredoxin [57804] (8 species)
  7. Species Pyrococcus furiosus [TaxId:2261] [57809] (30 PDB entries)
    Uniprot P24297
  8. Domain d1caaa_: 1caa A: [45239]
    complexed with fe

Details for d1caaa_

PDB Entry: 1caa (more details), 1.8 Å

PDB Description: x-ray crystal structures of the oxidized and reduced forms of the rubredoxin from the marine hyperthermophilic archaebacterium pyrococcus furiosus
PDB Compounds: (A:) rubredoxin

SCOPe Domain Sequences for d1caaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1caaa_ g.41.5.1 (A:) Rubredoxin {Pyrococcus furiosus [TaxId: 2261]}
akwvckicgyiydedagdpdngispgtkfeelpddwvcpicgapksefekled

SCOPe Domain Coordinates for d1caaa_ are not available.

Timeline for d1caaa_: