Class g: Small proteins [56992] (90 folds) |
Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
Superfamily g.41.5: Rubredoxin-like [57802] (4 families) |
Family g.41.5.1: Rubredoxin [57803] (5 proteins) |
Protein Rubredoxin [57804] (8 species) |
Species Pyrococcus furiosus [TaxId:2261] [57809] (25 PDB entries) Uniprot P24297 |
Domain d1bq8a_: 1bq8 A: [45237] complexed with fe; mutant |
PDB Entry: 1bq8 (more details), 1.1 Å
SCOPe Domain Sequences for d1bq8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bq8a_ g.41.5.1 (A:) Rubredoxin {Pyrococcus furiosus [TaxId: 2261]} makwvckicgyiydedagdpdngispgtkfeelpddwvcpicgapksefekled
Timeline for d1bq8a_: