Lineage for d1b2ja_ (1b2j A:)

  1. Root: SCOPe 2.08
  2. Class g: Small proteins [56992] (100 folds)
  3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. Superfamily g.41.5: Rubredoxin-like [57802] (4 families) (S)
  5. Family g.41.5.1: Rubredoxin [57803] (5 proteins)
  6. Protein Rubredoxin [57804] (8 species)
  7. Species Clostridium pasteurianum [TaxId:1501] [57808] (23 PDB entries)
    Uniprot P00268
  8. Domain d1b2ja_: 1b2j A: [45231]
    complexed with fe; mutant

Details for d1b2ja_

PDB Entry: 1b2j (more details), 1.6 Å

PDB Description: clostridium pasteurianum rubredoxin g43a mutant
PDB Compounds: (A:) protein (rubredoxin)

SCOPe Domain Sequences for d1b2ja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b2ja_ g.41.5.1 (A:) Rubredoxin {Clostridium pasteurianum [TaxId: 1501]}
mkkytctvcgyiynpedgdpdngvnpgtdfkdipddwvcplcavgkdqfeevee

SCOPe Domain Coordinates for d1b2ja_ are not available.

Timeline for d1b2ja_: