Lineage for d1rdv__ (1rdv -)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 41508Fold g.41: Rubredoxin-like [57769] (8 superfamilies)
  4. 41580Superfamily g.41.5: Rubredoxin-like [57802] (3 families) (S)
  5. 41581Family g.41.5.1: Rubredoxin [57803] (2 proteins)
  6. 41582Protein Rubredoxin [57804] (6 species)
  7. 41601Species Desulfovibrio vulgaris [TaxId:881] [57805] (5 PDB entries)
  8. 41608Domain d1rdv__: 1rdv - [45220]

Details for d1rdv__

PDB Entry: 1rdv (more details), 2 Å

PDB Description: rubredoxin from desulfovibrio vulgaris miyazaki f, trigonal crystal form

SCOP Domain Sequences for d1rdv__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rdv__ g.41.5.1 (-) Rubredoxin {Desulfovibrio vulgaris}
mkkyvctvcgyeydpaegdpdngvkpgtafedvpadwvcpicgapksefepa

SCOP Domain Coordinates for d1rdv__:

Click to download the PDB-style file with coordinates for d1rdv__.
(The format of our PDB-style files is described here.)

Timeline for d1rdv__: