Lineage for d2rdvb_ (2rdv B:)

  1. Root: SCOPe 2.03
  2. 1458801Class g: Small proteins [56992] (90 folds)
  3. 1464002Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 1464186Superfamily g.41.5: Rubredoxin-like [57802] (4 families) (S)
  5. 1464187Family g.41.5.1: Rubredoxin [57803] (5 proteins)
  6. 1464196Protein Rubredoxin [57804] (8 species)
  7. 1464234Species Desulfovibrio vulgaris [TaxId:881] [57805] (7 PDB entries)
  8. 1464239Domain d2rdvb_: 2rdv B: [45218]
    complexed with fe

Details for d2rdvb_

PDB Entry: 2rdv (more details), 1.9 Å

PDB Description: rubredoxin from desulfovibrio vulgaris miyazaki f, monoclinic crystal form
PDB Compounds: (B:) rubredoxin

SCOPe Domain Sequences for d2rdvb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rdvb_ g.41.5.1 (B:) Rubredoxin {Desulfovibrio vulgaris [TaxId: 881]}
mkkyvctvcgyeydpaegdpdngvkpgtafedvpadwvcpicgapksefepa

SCOPe Domain Coordinates for d2rdvb_:

Click to download the PDB-style file with coordinates for d2rdvb_.
(The format of our PDB-style files is described here.)

Timeline for d2rdvb_: