Lineage for d8rxna_ (8rxn A:)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 41508Fold g.41: Rubredoxin-like [57769] (8 superfamilies)
  4. 41580Superfamily g.41.5: Rubredoxin-like [57802] (3 families) (S)
  5. 41581Family g.41.5.1: Rubredoxin [57803] (2 proteins)
  6. 41582Protein Rubredoxin [57804] (6 species)
  7. 41601Species Desulfovibrio vulgaris [TaxId:881] [57805] (5 PDB entries)
  8. 41603Domain d8rxna_: 8rxn A: [45215]

Details for d8rxna_

PDB Entry: 8rxn (more details), 1 Å

PDB Description: refinement of rubredoxin from desulfovibrio vulgaris at 1.0 angstroms with and without restraints

SCOP Domain Sequences for d8rxna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d8rxna_ g.41.5.1 (A:) Rubredoxin {Desulfovibrio vulgaris}
mkkyvctvcgyeydpaegdpdngvkpgtsfddlpadwvcpvcgapksefeaa

SCOP Domain Coordinates for d8rxna_:

Click to download the PDB-style file with coordinates for d8rxna_.
(The format of our PDB-style files is described here.)

Timeline for d8rxna_: