Lineage for d1rb9__ (1rb9 -)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 41508Fold g.41: Rubredoxin-like [57769] (8 superfamilies)
  4. 41580Superfamily g.41.5: Rubredoxin-like [57802] (3 families) (S)
  5. 41581Family g.41.5.1: Rubredoxin [57803] (2 proteins)
  6. 41582Protein Rubredoxin [57804] (6 species)
  7. 41601Species Desulfovibrio vulgaris [TaxId:881] [57805] (5 PDB entries)
  8. 41602Domain d1rb9__: 1rb9 - [45214]

Details for d1rb9__

PDB Entry: 1rb9 (more details), 0.92 Å

PDB Description: rubredoxin from desulfovibrio vulgaris refined anisotropically at 0.92 angstroms resolution

SCOP Domain Sequences for d1rb9__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rb9__ g.41.5.1 (-) Rubredoxin {Desulfovibrio vulgaris}
mkkyvctvcgyeydpaegdpdngvkpgtsfddlpadwvcpvcgapksefeaa

SCOP Domain Coordinates for d1rb9__:

Click to download the PDB-style file with coordinates for d1rb9__.
(The format of our PDB-style files is described here.)

Timeline for d1rb9__: