Lineage for d1qf8b_ (1qf8 B:)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 41508Fold g.41: Rubredoxin-like [57769] (8 superfamilies)
  4. 41574Superfamily g.41.4: Casein kinase II beta subunit [57798] (1 family) (S)
  5. 41575Family g.41.4.1: Casein kinase II beta subunit [57799] (1 protein)
  6. 41576Protein Casein kinase II beta subunit [57800] (1 species)
  7. 41577Species Human (Homo sapiens) [TaxId:9606] [57801] (1 PDB entry)
  8. 41579Domain d1qf8b_: 1qf8 B: [45213]

Details for d1qf8b_

PDB Entry: 1qf8 (more details), 1.74 Å

PDB Description: truncated form of casein kinase ii beta subunit (2-182) from homo sapiens

SCOP Domain Sequences for d1qf8b_:

Sequence, based on SEQRES records: (download)

>d1qf8b_ g.41.4.1 (B:) Casein kinase II beta subunit {Human (Homo sapiens)}
evswiswfcglrgneffcevdedyiqdkfnltglneqvphyrqaldmildlepdeeledn
pnqsdlieqaaemlygliharyiltnrgiaqmlekyqqgdfgycprvycenqpmlpigls
dipgeamvklycpkcmdvytpkssrhhhtdgayfgtgfphmlfmvhpeyrp

Sequence, based on observed residues (ATOM records): (download)

>d1qf8b_ g.41.4.1 (B:) Casein kinase II beta subunit {Human (Homo sapiens)}
evswiswfcglrgneffcevdedyiqdkfnltglneqvphyrqaldmildlepnqsdlie
qaaemlygliharyiltnrgiaqmlekyqqgdfgycprvycenqpmlpiglsdipgeamv
klycpkcmdvytpkssrhhhtdgayfgtgfphmlfmvhpeyrp

SCOP Domain Coordinates for d1qf8b_:

Click to download the PDB-style file with coordinates for d1qf8b_.
(The format of our PDB-style files is described here.)

Timeline for d1qf8b_: