Lineage for d1qf8b_ (1qf8 B:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3036286Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 3036480Superfamily g.41.4: Casein kinase II beta subunit [57798] (1 family) (S)
    automatically mapped to Pfam PF01214
  5. 3036481Family g.41.4.1: Casein kinase II beta subunit [57799] (1 protein)
    contains alpha-helices in the N- and C-terminal extensions (linkers?)
  6. 3036482Protein Casein kinase II beta subunit [57800] (3 species)
  7. 3036492Species Human (Homo sapiens) [TaxId:9606] [57801] (5 PDB entries)
  8. 3036494Domain d1qf8b_: 1qf8 B: [45213]
    complexed with mg, zn

Details for d1qf8b_

PDB Entry: 1qf8 (more details), 1.74 Å

PDB Description: truncated form of casein kinase ii beta subunit (2-182) from homo sapiens
PDB Compounds: (B:) casein kinase II

SCOPe Domain Sequences for d1qf8b_:

Sequence, based on SEQRES records: (download)

>d1qf8b_ g.41.4.1 (B:) Casein kinase II beta subunit {Human (Homo sapiens) [TaxId: 9606]}
evswiswfcglrgneffcevdedyiqdkfnltglneqvphyrqaldmildlepdeeledn
pnqsdlieqaaemlygliharyiltnrgiaqmlekyqqgdfgycprvycenqpmlpigls
dipgeamvklycpkcmdvytpkssrhhhtdgayfgtgfphmlfmvhpeyrp

Sequence, based on observed residues (ATOM records): (download)

>d1qf8b_ g.41.4.1 (B:) Casein kinase II beta subunit {Human (Homo sapiens) [TaxId: 9606]}
evswiswfcglrgneffcevdedyiqdkfnltglneqvphyrqaldmildlepnqsdlie
qaaemlygliharyiltnrgiaqmlekyqqgdfgycprvycenqpmlpiglsdipgeamv
klycpkcmdvytpkssrhhhtdgayfgtgfphmlfmvhpeyrp

SCOPe Domain Coordinates for d1qf8b_:

Click to download the PDB-style file with coordinates for d1qf8b_.
(The format of our PDB-style files is described here.)

Timeline for d1qf8b_: