Lineage for d1d0qb_ (1d0q B:)
- Root: SCOP 1.55
Class g: Small proteins [56992] (54 folds) 
Fold g.41: Rubredoxin-like [57769] (8 superfamilies) 
Superfamily g.41.3: Zinc beta-ribbon [57783] (3 families) 
Family g.41.3.2: Zinc-binding domain of DNA primase [57792] (1 protein) Protein Zinc-binding domain of DNA primase [57793] (1 species) Species Bacillus stearothermophilus [TaxId:1422] [57794] (1 PDB entry) 
Domain d1d0qb_: 1d0q B: [45209]
Details for d1d0qb_
PDB Entry: 1d0q (more details), 1.71 Å
PDB Description: structure of the zinc-binding domain of bacillus stearothermophilus dna primase
SCOP Domain Sequences for d1d0qb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d0qb_ g.41.3.2 (B:) Zinc-binding domain of DNA primase {Bacillus stearothermophilus}
ghripeetieairrgvdivdvigeyvqlkrqgrnyfglcpfhgektpsfsvspekqifhc
fgcgaggnaftflmdiegipfveaakrlaakagvdlsvyeld
SCOP Domain Coordinates for d1d0qb_:
Click to download the PDB-style file with coordinates for d1d0qb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1d0qb_:
- d1d0qb_ appears in SCOP 1.57
- d1d0qb_ appears in the current release, SCOPe 2.08
View in 3D
