SCOPe 2.08: Domain d1d0qb_: 1d0q B:

Lineage for d1d0qb_ (1d0q B:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.3: Zinc beta-ribbon [57783] (6 families)

5. Family g.41.3.2: DNA primase zinc finger [57792] (2 proteins)
   contains alpha-helices in the N- and C-terminal extensions (linkers?)

6. Protein Zinc-binding domain of DNA primase [57793] (1 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [57794] (1 PDB entry)

8. Domain d1d0qb_: 1d0q B: [45209]
   complexed with zn
   has additional subdomain(s) that are not in the common domain

Details for d1d0qb_

PDB Entry: 1d0q, 1.71 Å

PDB Description: structure of the zinc-binding domain of bacillus stearothermophilus dna primase

PDB Compounds: (B:) DNA primase

SCOPe Domain Sequences for d1d0qb_:

Sequence; same for both SEQRES and ATOM records:

>d1d0qb_ g.41.3.2 (B:) Zinc-binding domain of DNA primase {Bacillus stearothermophilus [TaxId: 1422]}
ghripeetieairrgvdivdvigeyvqlkrqgrnyfglcpfhgektpsfsvspekqifhc
fgcgaggnaftflmdiegipfveaakrlaakagvdlsvyeld

Timeline for d1d0qb_:

• d1d0qb_ first appeared (with stable ids) in SCOP 1.55
  
• d1d0qb_ appears in SCOPe 2.07