Lineage for d1d0qb_ (1d0q B:)

  1. Root: SCOPe 2.08
  2. Class g: Small proteins [56992] (100 folds)
  3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. Superfamily g.41.3: Zinc beta-ribbon [57783] (6 families) (S)
  5. Family g.41.3.2: DNA primase zinc finger [57792] (2 proteins)
    contains alpha-helices in the N- and C-terminal extensions (linkers?)
  6. Protein Zinc-binding domain of DNA primase [57793] (1 species)
  7. Species Bacillus stearothermophilus [TaxId:1422] [57794] (1 PDB entry)
  8. Domain d1d0qb_: 1d0q B: [45209]
    complexed with zn

Details for d1d0qb_

PDB Entry: 1d0q (more details), 1.71 Å

PDB Description: structure of the zinc-binding domain of bacillus stearothermophilus dna primase
PDB Compounds: (B:) DNA primase

SCOPe Domain Sequences for d1d0qb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d0qb_ g.41.3.2 (B:) Zinc-binding domain of DNA primase {Bacillus stearothermophilus [TaxId: 1422]}
ghripeetieairrgvdivdvigeyvqlkrqgrnyfglcpfhgektpsfsvspekqifhc
fgcgaggnaftflmdiegipfveaakrlaakagvdlsvyeld

SCOPe Domain Coordinates for d1d0qb_ are not available.

Timeline for d1d0qb_:

Domains from other chains:
(mouse over for more information)
d1d0qa_