![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
![]() | Superfamily g.41.3: Zinc beta-ribbon [57783] (6 families) ![]() |
![]() | Family g.41.3.2: DNA primase zinc finger [57792] (2 proteins) contains alpha-helices in the N- and C-terminal extensions (linkers?) |
![]() | Protein Zinc-binding domain of DNA primase [57793] (1 species) |
![]() | Species Bacillus stearothermophilus [TaxId:1422] [57794] (1 PDB entry) |
![]() | Domain d1d0qb_: 1d0q B: [45209] complexed with zn has additional subdomain(s) that are not in the common domain |
PDB Entry: 1d0q (more details), 1.71 Å
SCOPe Domain Sequences for d1d0qb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d0qb_ g.41.3.2 (B:) Zinc-binding domain of DNA primase {Bacillus stearothermophilus [TaxId: 1422]} ghripeetieairrgvdivdvigeyvqlkrqgrnyfglcpfhgektpsfsvspekqifhc fgcgaggnaftflmdiegipfveaakrlaakagvdlsvyeld
Timeline for d1d0qb_: