Lineage for d1d0qa_ (1d0q A:)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 41508Fold g.41: Rubredoxin-like [57769] (8 superfamilies)
  4. 41551Superfamily g.41.3: Zinc beta-ribbon [57783] (3 families) (S)
  5. 41564Family g.41.3.2: Zinc-binding domain of DNA primase [57792] (1 protein)
  6. 41565Protein Zinc-binding domain of DNA primase [57793] (1 species)
  7. 41566Species Bacillus stearothermophilus [TaxId:1422] [57794] (1 PDB entry)
  8. 41567Domain d1d0qa_: 1d0q A: [45208]

Details for d1d0qa_

PDB Entry: 1d0q (more details), 1.71 Å

PDB Description: structure of the zinc-binding domain of bacillus stearothermophilus dna primase

SCOP Domain Sequences for d1d0qa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d0qa_ g.41.3.2 (A:) Zinc-binding domain of DNA primase {Bacillus stearothermophilus}
ghripeetieairrgvdivdvigeyvqlkrqgrnyfglcpfhgektpsfsvspekqifhc
fgcgaggnaftflmdiegipfveaakrlaakagvdlsvyeld

SCOP Domain Coordinates for d1d0qa_:

Click to download the PDB-style file with coordinates for d1d0qa_.
(The format of our PDB-style files is described here.)

Timeline for d1d0qa_: