Lineage for d1qypa_ (1qyp A:)

  1. Root: SCOPe 2.03
  2. 1458801Class g: Small proteins [56992] (90 folds)
  3. 1464002Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 1464070Superfamily g.41.3: Zinc beta-ribbon [57783] (5 families) (S)
  5. 1464071Family g.41.3.1: Transcriptional factor domain [57784] (4 proteins)
  6. 1464072Protein RBP9 subunit of RNA polymerase II [57787] (3 species)
    contains two differently decorated domains of this fold
  7. 1464127Species Thermococcus celer [TaxId:2264] [57788] (1 PDB entry)
  8. 1464128Domain d1qypa_: 1qyp A: [45205]
    C-terminal domain
    complexed with zn

Details for d1qypa_

PDB Entry: 1qyp (more details)

PDB Description: thermococcus celer rpb9, nmr, 25 structures
PDB Compounds: (A:) RNA polymerase II

SCOPe Domain Sequences for d1qypa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qypa_ g.41.3.1 (A:) RBP9 subunit of RNA polymerase II {Thermococcus celer [TaxId: 2264]}
gshmeqdlktlpttkitcpkcgndtaywwemqtragdepstifykctkcghtwrsye

SCOPe Domain Coordinates for d1qypa_:

Click to download the PDB-style file with coordinates for d1qypa_.
(The format of our PDB-style files is described here.)

Timeline for d1qypa_: