Lineage for d1qyp__ (1qyp -)

  1. Root: SCOP 1.59
  2. 142453Class g: Small proteins [56992] (58 folds)
  3. 144883Fold g.41: Rubredoxin-like [57769] (9 superfamilies)
  4. 145106Superfamily g.41.9: Zn-binding RNA polymerase subunits [63393] (2 families) (S)
  5. 145107Family g.41.9.1: RBP9 subunit of RNA polymerase II [63394] (1 protein)
  6. 145108Protein RBP9 subunit of RNA polymerase II [57787] (2 species)
  7. 145109Species Archaeon Thermococcus celer [TaxId:2264] [57788] (1 PDB entry)
  8. 145110Domain d1qyp__: 1qyp - [45205]

Details for d1qyp__

PDB Entry: 1qyp (more details)

PDB Description: thermococcus celer rpb9, nmr, 25 structures
PDB Compounds: ( :)

SCOP Domain Sequences for d1qyp__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qyp__ g.41.9.1 (-) RBP9 subunit of RNA polymerase II {Archaeon Thermococcus celer}
gshmeqdlktlpttkitcpkcgndtaywwemqtragdepstifykctkcghtwrsye

SCOP Domain Coordinates for d1qyp__:

Click to download the PDB-style file with coordinates for d1qyp__.
(The format of our PDB-style files is described here.)

Timeline for d1qyp__: