Lineage for d1zakb2 (1zak B:128-158)

  1. Root: SCOP 1.63
  2. 268577Class g: Small proteins [56992] (61 folds)
  3. 271305Fold g.41: Rubredoxin-like [57769] (10 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 271314Superfamily g.41.2: Microbial and mitochondrial ADK, insert "zinc finger" domain [57774] (1 family) (S)
  5. 271315Family g.41.2.1: Microbial and mitochondrial ADK, insert "zinc finger" domain [57775] (1 protein)
  6. 271316Protein Microbial and mitochondrial ADK, insert "zinc finger" domain [57776] (6 species)
  7. 271346Species Maize (Zea mays) [TaxId:4577] [57782] (1 PDB entry)
  8. 271348Domain d1zakb2: 1zak B:128-158 [45203]
    Other proteins in same PDB: d1zaka1, d1zakb1
    contains a rudiment "zinc-finger" subdomain
    complexed with ap5

Details for d1zakb2

PDB Entry: 1zak (more details), 3.5 Å

PDB Description: adenylate kinase from maize in complex with the inhibitor p1,p5-bis(adenosine-5'-)pentaphosphate (ap5a)

SCOP Domain Sequences for d1zakb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zakb2 g.41.2.1 (B:128-158) Microbial and mitochondrial ADK, insert "zinc finger" domain {Maize (Zea mays)}
grrldpvtgkiyhlkysppeneeiasrltqr

SCOP Domain Coordinates for d1zakb2:

Click to download the PDB-style file with coordinates for d1zakb2.
(The format of our PDB-style files is described here.)

Timeline for d1zakb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zakb1