Lineage for d1zakb2 (1zak B:128-158)

  1. Root: SCOP 1.61
  2. 202290Class g: Small proteins [56992] (59 folds)
  3. 204875Fold g.41: Rubredoxin-like [57769] (9 superfamilies)
  4. 204884Superfamily g.41.2: Microbial and mitochondrial ADK, insert "zinc finger" domain [57774] (1 family) (S)
  5. 204885Family g.41.2.1: Microbial and mitochondrial ADK, insert "zinc finger" domain [57775] (1 protein)
  6. 204886Protein Microbial and mitochondrial ADK, insert "zinc finger" domain [57776] (6 species)
  7. 204916Species Maize (Zea mays) [TaxId:4577] [57782] (1 PDB entry)
  8. 204918Domain d1zakb2: 1zak B:128-158 [45203]
    Other proteins in same PDB: d1zaka1, d1zakb1

Details for d1zakb2

PDB Entry: 1zak (more details), 3.5 Å

PDB Description: adenylate kinase from maize in complex with the inhibitor p1,p5-bis(adenosine-5'-)pentaphosphate (ap5a)

SCOP Domain Sequences for d1zakb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zakb2 g.41.2.1 (B:128-158) Microbial and mitochondrial ADK, insert "zinc finger" domain {Maize (Zea mays)}
grrldpvtgkiyhlkysppeneeiasrltqr

SCOP Domain Coordinates for d1zakb2:

Click to download the PDB-style file with coordinates for d1zakb2.
(The format of our PDB-style files is described here.)

Timeline for d1zakb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zakb1