SCOP 1.59: Domain d1zakb2: 1zak B:128-158

Lineage for d1zakb2 (1zak B:128-158)

1. Root: SCOP 1.59

2. Class g: Small proteins [56992] (58 folds)

3. Fold g.41: Rubredoxin-like [57769] (9 superfamilies)

4. Superfamily g.41.2: Microbial and mitochondrial ADK, insert "zinc finger" domain [57774] (1 family)

5. Family g.41.2.1: Microbial and mitochondrial ADK, insert "zinc finger" domain [57775] (1 protein)

6. Protein Microbial and mitochondrial ADK, insert "zinc finger" domain [57776] (6 species)

7. Species Maize (Zea mays) [TaxId:4577] [57782] (1 PDB entry)

8. Domain d1zakb2: 1zak B:128-158 [45203]
   Other proteins in same PDB: d1zaka1, d1zakb1

Details for d1zakb2

PDB Entry: 1zak, 3.5 Å

PDB Description: adenylate kinase from maize in complex with the inhibitor p1,p5-bis(adenosine-5'-)pentaphosphate (ap5a)

SCOP Domain Sequences for d1zakb2:

Sequence; same for both SEQRES and ATOM records:

>d1zakb2 g.41.2.1 (B:128-158) Microbial and mitochondrial ADK, insert "zinc finger" domain {Maize (Zea mays)}
grrldpvtgkiyhlkysppeneeiasrltqr

Timeline for d1zakb2:

• d1zakb2 first appeared (with stable ids) in SCOP 1.55
  
• d1zakb2 appears in SCOP 1.57
  
• d1zakb2 appears in SCOP 1.61
  
• d1zakb2 appears in the current release, SCOPe 2.08