Lineage for d1zaka2 (1zak A:128-158)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 750692Fold g.41: Rubredoxin-like [57769] (16 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 750708Superfamily g.41.2: Microbial and mitochondrial ADK, insert "zinc finger" domain [57774] (1 family) (S)
  5. 750709Family g.41.2.1: Microbial and mitochondrial ADK, insert "zinc finger" domain [57775] (1 protein)
  6. 750710Protein Microbial and mitochondrial ADK, insert "zinc finger" domain [57776] (8 species)
  7. 750744Species Maize (Zea mays) [TaxId:4577] [57782] (1 PDB entry)
  8. 750745Domain d1zaka2: 1zak A:128-158 [45202]
    Other proteins in same PDB: d1zaka1, d1zakb1

Details for d1zaka2

PDB Entry: 1zak (more details), 3.5 Å

PDB Description: adenylate kinase from maize in complex with the inhibitor p1,p5-bis(adenosine-5'-)pentaphosphate (ap5a)
PDB Compounds: (A:) adenylate kinase

SCOP Domain Sequences for d1zaka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zaka2 g.41.2.1 (A:128-158) Microbial and mitochondrial ADK, insert "zinc finger" domain {Maize (Zea mays) [TaxId: 4577]}
grrldpvtgkiyhlkysppeneeiasrltqr

SCOP Domain Coordinates for d1zaka2:

Click to download the PDB-style file with coordinates for d1zaka2.
(The format of our PDB-style files is described here.)

Timeline for d1zaka2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zaka1