![]() | Class g: Small proteins [56992] (79 folds) |
![]() | Fold g.41: Rubredoxin-like [57769] (14 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
![]() | Superfamily g.41.2: Microbial and mitochondrial ADK, insert "zinc finger" domain [57774] (1 family) ![]() |
![]() | Family g.41.2.1: Microbial and mitochondrial ADK, insert "zinc finger" domain [57775] (1 protein) |
![]() | Protein Microbial and mitochondrial ADK, insert "zinc finger" domain [57776] (8 species) |
![]() | Species Maize (Zea mays) [TaxId:4577] [57782] (1 PDB entry) |
![]() | Domain d1zaka2: 1zak A:128-158 [45202] Other proteins in same PDB: d1zaka1, d1zakb1 |
PDB Entry: 1zak (more details), 3.5 Å
SCOP Domain Sequences for d1zaka2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zaka2 g.41.2.1 (A:128-158) Microbial and mitochondrial ADK, insert "zinc finger" domain {Maize (Zea mays)} grrldpvtgkiyhlkysppeneeiasrltqr
Timeline for d1zaka2: