Lineage for d1dvra2 (1dvr A:131-168)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3036286Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 3036302Superfamily g.41.2: Microbial and mitochondrial ADK, insert 'zinc finger' domain [57774] (2 families) (S)
    automatically mapped to Pfam PF05191
  5. 3036303Family g.41.2.1: Microbial and mitochondrial ADK, insert 'zinc finger' domain [57775] (1 protein)
  6. 3036304Protein Microbial and mitochondrial ADK, insert 'zinc finger' domain [57776] (9 species)
  7. 3036313Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [57781] (4 PDB entries)
    contains a rudiment "zinc-finger" subdomain
  8. 3036317Domain d1dvra2: 1dvr A:131-168 [45200]
    Other proteins in same PDB: d1dvra1, d1dvrb1
    complexed with atf; mutant

Details for d1dvra2

PDB Entry: 1dvr (more details), 2.36 Å

PDB Description: structure of a mutant adenylate kinase ligated with an atp-analogue showing domain closure over atp
PDB Compounds: (A:) adenylate kinase

SCOPe Domain Sequences for d1dvra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dvra2 g.41.2.1 (A:131-168) Microbial and mitochondrial ADK, insert 'zinc finger' domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
grlihpasgrsyhkifnppkedmkddvtgealvqisdd

SCOPe Domain Coordinates for d1dvra2:

Click to download the PDB-style file with coordinates for d1dvra2.
(The format of our PDB-style files is described here.)

Timeline for d1dvra2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dvra1