Lineage for d3aky_2 (3aky 131-168)
- Root: SCOP 1.57
Class g: Small proteins [56992] (56 folds) 
Fold g.41: Rubredoxin-like [57769] (9 superfamilies) 
Superfamily g.41.2: Microbial and mitochondrial ADK, insert "zinc finger" domain [57774] (1 family) 
Family g.41.2.1: Microbial and mitochondrial ADK, insert "zinc finger" domain [57775] (1 protein) Protein Microbial and mitochondrial ADK, insert "zinc finger" domain [57776] (6 species) 
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [57781] (4 PDB entries) 
Domain d3aky_2: 3aky 131-168 [45199]
Other proteins in same PDB: d3aky_1
Details for d3aky_2
PDB Entry: 3aky (more details), 2.23 Å
PDB Description: stability, activity and structure of adenylate kinase mutants
SCOP Domain Sequences for d3aky_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3aky_2 g.41.2.1 (131-168) Microbial and mitochondrial ADK, insert "zinc finger" domain {Baker's yeast (Saccharomyces cerevisiae)}
grlihpasgrsyhkifnppkedmkddvtgealvqrsdd
SCOP Domain Coordinates for d3aky_2:
Click to download the PDB-style file with coordinates for d3aky_2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3aky_2:
- d3aky_2 first appeared (with stable ids) in SCOP 1.55
- d3aky_2 appears in SCOP 1.59
- d3aky_2 appears in the current release, SCOPe 2.08, called d3akya2
View in 3D
