![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
![]() | Superfamily g.41.2: Microbial and mitochondrial ADK, insert 'zinc finger' domain [57774] (2 families) ![]() automatically mapped to Pfam PF05191 |
![]() | Family g.41.2.1: Microbial and mitochondrial ADK, insert 'zinc finger' domain [57775] (1 protein) |
![]() | Protein Microbial and mitochondrial ADK, insert 'zinc finger' domain [57776] (9 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [57781] (4 PDB entries) contains a rudiment "zinc-finger" subdomain |
![]() | Domain d3akya2: 3aky A:131-168 [45199] Other proteins in same PDB: d3akya1 complexed with ap5, imd; mutant |
PDB Entry: 3aky (more details), 2.23 Å
SCOPe Domain Sequences for d3akya2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3akya2 g.41.2.1 (A:131-168) Microbial and mitochondrial ADK, insert 'zinc finger' domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} grlihpasgrsyhkifnppkedmkddvtgealvqrsdd
Timeline for d3akya2: