SCOP 1.61: Domain d2aky_2: 2aky 131-168

Lineage for d2aky_2 (2aky 131-168)

1. Root: SCOP 1.61

2. Class g: Small proteins [56992] (59 folds)

3. Fold g.41: Rubredoxin-like [57769] (9 superfamilies)

4. Superfamily g.41.2: Microbial and mitochondrial ADK, insert "zinc finger" domain [57774] (1 family)

5. Family g.41.2.1: Microbial and mitochondrial ADK, insert "zinc finger" domain [57775] (1 protein)

6. Protein Microbial and mitochondrial ADK, insert "zinc finger" domain [57776] (6 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [57781] (4 PDB entries)

8. Domain d2aky_2: 2aky 131-168 [45198]
   Other proteins in same PDB: d2aky_1

Details for d2aky_2

PDB Entry: 2aky, 1.96 Å

PDB Description: high-resolution structures of adenylate kinase from yeast ligated with inhibitor ap5a, showing the pathway of phosphoryl transfer

SCOP Domain Sequences for d2aky_2:

Sequence; same for both SEQRES and ATOM records:

>d2aky_2 g.41.2.1 (131-168) Microbial and mitochondrial ADK, insert "zinc finger" domain {Baker's yeast (Saccharomyces cerevisiae)}
grlihpasgrsyhkifnppkedmkddvtgealvqrsdd

Timeline for d2aky_2:

• d2aky_2 first appeared (with stable ids) in SCOP 1.55
  
• d2aky_2 appears in SCOP 1.59
  
• d2aky_2 appears in SCOP 1.63
  
• d2aky_2 appears in the current release, SCOPe 2.08, called d2akya2