Lineage for d2aky_2 (2aky 131-168)

  1. Root: SCOP 1.59
  2. 142453Class g: Small proteins [56992] (58 folds)
  3. 144883Fold g.41: Rubredoxin-like [57769] (9 superfamilies)
  4. 144892Superfamily g.41.2: Microbial and mitochondrial ADK, insert "zinc finger" domain [57774] (1 family) (S)
  5. 144893Family g.41.2.1: Microbial and mitochondrial ADK, insert "zinc finger" domain [57775] (1 protein)
  6. 144894Protein Microbial and mitochondrial ADK, insert "zinc finger" domain [57776] (6 species)
  7. 144899Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [57781] (4 PDB entries)
  8. 144901Domain d2aky_2: 2aky 131-168 [45198]
    Other proteins in same PDB: d2aky_1

Details for d2aky_2

PDB Entry: 2aky (more details), 1.96 Å

PDB Description: high-resolution structures of adenylate kinase from yeast ligated with inhibitor ap5a, showing the pathway of phosphoryl transfer

SCOP Domain Sequences for d2aky_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aky_2 g.41.2.1 (131-168) Microbial and mitochondrial ADK, insert "zinc finger" domain {Baker's yeast (Saccharomyces cerevisiae)}
grlihpasgrsyhkifnppkedmkddvtgealvqrsdd

SCOP Domain Coordinates for d2aky_2:

Click to download the PDB-style file with coordinates for d2aky_2.
(The format of our PDB-style files is described here.)

Timeline for d2aky_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2aky_1