SCOPe 2.08: Domain d1akya2: 1aky A:131-168

Lineage for d1akya2 (1aky A:131-168)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.2: Microbial and mitochondrial ADK, insert 'zinc finger' domain [57774] (2 families)
   automatically mapped to Pfam PF05191

5. Family g.41.2.1: Microbial and mitochondrial ADK, insert 'zinc finger' domain [57775] (1 protein)

6. Protein Microbial and mitochondrial ADK, insert 'zinc finger' domain [57776] (9 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [57781] (4 PDB entries)
   contains a rudiment "zinc-finger" subdomain

8. Domain d1akya2: 1aky A:131-168 [45197]
   Other proteins in same PDB: d1akya1
   complexed with ap5, imd

Details for d1akya2

PDB Entry: 1aky, 1.63 Å

PDB Description: high-resolution structures of adenylate kinase from yeast ligated with inhibitor ap5a, showing the pathway of phosphoryl transfer

PDB Compounds: (A:) adenylate kinase

SCOPe Domain Sequences for d1akya2:

Sequence; same for both SEQRES and ATOM records:

>d1akya2 g.41.2.1 (A:131-168) Microbial and mitochondrial ADK, insert 'zinc finger' domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
grlihpasgrsyhkifnppkedmkddvtgealvqrsdd

Timeline for d1akya2:

• d1akya2 first appeared (with stable ids) in SCOP 1.55, called d1aky_2
  
• d1akya2 appears in SCOPe 2.07