Lineage for d1ak2a2 (1ak2 A:147-176)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2640990Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 2641006Superfamily g.41.2: Microbial and mitochondrial ADK, insert "zinc finger" domain [57774] (2 families) (S)
    automatically mapped to Pfam PF05191
  5. 2641007Family g.41.2.1: Microbial and mitochondrial ADK, insert "zinc finger" domain [57775] (1 protein)
  6. 2641008Protein Microbial and mitochondrial ADK, insert "zinc finger" domain [57776] (9 species)
  7. 2641023Species Cow (Bos taurus), mitochondrial izozyme-2 [TaxId:9913] [57780] (2 PDB entries)
    contains a rudiment "zinc-finger" subdomain
  8. 2641024Domain d1ak2a2: 1ak2 A:147-176 [45195]
    Other proteins in same PDB: d1ak2a1
    complexed with so4

Details for d1ak2a2

PDB Entry: 1ak2 (more details), 1.92 Å

PDB Description: adenylate kinase isoenzyme-2
PDB Compounds: (A:) adenylate kinase isoenzyme-2

SCOPe Domain Sequences for d1ak2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ak2a2 g.41.2.1 (A:147-176) Microbial and mitochondrial ADK, insert "zinc finger" domain {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]}
pqsgrsyheefnppkepmkdditgeplirr

SCOPe Domain Coordinates for d1ak2a2:

Click to download the PDB-style file with coordinates for d1ak2a2.
(The format of our PDB-style files is described here.)

Timeline for d1ak2a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ak2a1