![]() | Class g: Small proteins [56992] (79 folds) |
![]() | Fold g.41: Rubredoxin-like [57769] (14 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
![]() | Superfamily g.41.2: Microbial and mitochondrial ADK, insert "zinc finger" domain [57774] (1 family) ![]() |
![]() | Family g.41.2.1: Microbial and mitochondrial ADK, insert "zinc finger" domain [57775] (1 protein) |
![]() | Protein Microbial and mitochondrial ADK, insert "zinc finger" domain [57776] (8 species) |
![]() | Species Cow (Bos taurus), mitochondrial izozyme-2 [TaxId:9913] [57780] (2 PDB entries) contains a rudiment "zinc-finger" subdomain |
![]() | Domain d1ak2_2: 1ak2 147-176 [45195] Other proteins in same PDB: d1ak2_1 complexed with so4 |
PDB Entry: 1ak2 (more details), 1.92 Å
SCOP Domain Sequences for d1ak2_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ak2_2 g.41.2.1 (147-176) Microbial and mitochondrial ADK, insert "zinc finger" domain {Cow (Bos taurus), mitochondrial izozyme-2} pqsgrsyheefnppkepmkdditgeplirr
Timeline for d1ak2_2: