![]() | Class g: Small proteins [56992] (79 folds) |
![]() | Fold g.41: Rubredoxin-like [57769] (14 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
![]() | Superfamily g.41.2: Microbial and mitochondrial ADK, insert "zinc finger" domain [57774] (1 family) ![]() |
![]() | Family g.41.2.1: Microbial and mitochondrial ADK, insert "zinc finger" domain [57775] (1 protein) |
![]() | Protein Microbial and mitochondrial ADK, insert "zinc finger" domain [57776] (8 species) |
![]() | Species Cow (Bos taurus), mitochondrial izozyme-3 [TaxId:9913] [57779] (1 PDB entry) contains a rudiment "zinc-finger" subdomain |
![]() | Domain d2ak3a2: 2ak3 A:125-161 [45193] Other proteins in same PDB: d2ak3a1, d2ak3b1 |
PDB Entry: 2ak3 (more details), 1.85 Å
SCOP Domain Sequences for d2ak3a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ak3a2 g.41.2.1 (A:125-161) Microbial and mitochondrial ADK, insert "zinc finger" domain {Cow (Bos taurus), mitochondrial izozyme-3} arwihpgsgrvyniefnppktmgiddltgeplvqred
Timeline for d2ak3a2: