Lineage for d2ak3a2 (2ak3 A:125-161)

  1. Root: SCOP 1.69
  2. 520835Class g: Small proteins [56992] (75 folds)
  3. 524121Fold g.41: Rubredoxin-like [57769] (13 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 524137Superfamily g.41.2: Microbial and mitochondrial ADK, insert "zinc finger" domain [57774] (1 family) (S)
  5. 524138Family g.41.2.1: Microbial and mitochondrial ADK, insert "zinc finger" domain [57775] (1 protein)
  6. 524139Protein Microbial and mitochondrial ADK, insert "zinc finger" domain [57776] (8 species)
  7. 524157Species Cow (Bos taurus), mitochondrial izozyme-3 [TaxId:9913] [57779] (1 PDB entry)
    contains a rudiment "zinc-finger" subdomain
  8. 524158Domain d2ak3a2: 2ak3 A:125-161 [45193]
    Other proteins in same PDB: d2ak3a1, d2ak3b1

Details for d2ak3a2

PDB Entry: 2ak3 (more details), 1.85 Å

PDB Description: the three-dimensional structure of the complex between mitochondrial matrix adenylate kinase and its substrate amp at 1.85 angstroms resolution

SCOP Domain Sequences for d2ak3a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ak3a2 g.41.2.1 (A:125-161) Microbial and mitochondrial ADK, insert "zinc finger" domain {Cow (Bos taurus), mitochondrial izozyme-3}
arwihpgsgrvyniefnppktmgiddltgeplvqred

SCOP Domain Coordinates for d2ak3a2:

Click to download the PDB-style file with coordinates for d2ak3a2.
(The format of our PDB-style files is described here.)

Timeline for d2ak3a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ak3a1