SCOP 1.67: Domain d2eckb2: 2eck B:122-156

Lineage for d2eckb2 (2eck B:122-156)

1. Root: SCOP 1.67

2. Class g: Small proteins [56992] (72 folds)

3. Fold g.41: Rubredoxin-like [57769] (13 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.2: Microbial and mitochondrial ADK, insert "zinc finger" domain [57774] (1 family)

5. Family g.41.2.1: Microbial and mitochondrial ADK, insert "zinc finger" domain [57775] (1 protein)

6. Protein Microbial and mitochondrial ADK, insert "zinc finger" domain [57776] (8 species)

7. Species Escherichia coli [TaxId:562] [57778] (6 PDB entries)
   contains a rudiment form of the domain that lacks zn-binding site

8. Domain d2eckb2: 2eck B:122-156 [45192]
   Other proteins in same PDB: d2ecka1, d2eckb1
   complexed with adp, amp

Details for d2eckb2

PDB Entry: 2eck, 2.8 Å

PDB Description: structure of phosphotransferase

SCOP Domain Sequences for d2eckb2:

Sequence; same for both SEQRES and ATOM records:

>d2eckb2 g.41.2.1 (B:122-156) Microbial and mitochondrial ADK, insert "zinc finger" domain {Escherichia coli}
grrvhapsgrvyhvkfnppkvegkddvtgeelttr

Timeline for d2eckb2:

• d2eckb2 first appeared (with stable ids) in SCOP 1.55
  
• d2eckb2 appears in SCOP 1.65
  
• d2eckb2 appears in SCOP 1.69
  
• d2eckb2 appears in the current release, SCOPe 2.08