Lineage for d1akeb2 (1ake B:122-156)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 892941Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 892957Superfamily g.41.2: Microbial and mitochondrial ADK, insert "zinc finger" domain [57774] (1 family) (S)
  5. 892958Family g.41.2.1: Microbial and mitochondrial ADK, insert "zinc finger" domain [57775] (1 protein)
  6. 892959Protein Microbial and mitochondrial ADK, insert "zinc finger" domain [57776] (8 species)
  7. 892980Species Escherichia coli [TaxId:562] [57778] (6 PDB entries)
    contains a rudiment form of the domain that lacks zn-binding site
  8. 892986Domain d1akeb2: 1ake B:122-156 [45186]
    Other proteins in same PDB: d1akea1, d1akeb1
    complexed with ap5

Details for d1akeb2

PDB Entry: 1ake (more details), 2 Å

PDB Description: structure of the complex between adenylate kinase from escherichia coli and the inhibitor ap5a refined at 1.9 angstroms resolution: a model for a catalytic transition state
PDB Compounds: (B:) adenylate kinase

SCOP Domain Sequences for d1akeb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1akeb2 g.41.2.1 (B:122-156) Microbial and mitochondrial ADK, insert "zinc finger" domain {Escherichia coli [TaxId: 562]}
grrvhapsgrvyhvkfnppkvegkddvtgeelttr

SCOP Domain Coordinates for d1akeb2:

Click to download the PDB-style file with coordinates for d1akeb2.
(The format of our PDB-style files is described here.)

Timeline for d1akeb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1akeb1