Lineage for d1akea2 (1ake A:122-156)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1065992Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 1066008Superfamily g.41.2: Microbial and mitochondrial ADK, insert "zinc finger" domain [57774] (1 family) (S)
  5. 1066009Family g.41.2.1: Microbial and mitochondrial ADK, insert "zinc finger" domain [57775] (1 protein)
  6. 1066010Protein Microbial and mitochondrial ADK, insert "zinc finger" domain [57776] (8 species)
  7. 1066031Species Escherichia coli [TaxId:562] [57778] (6 PDB entries)
    contains a rudiment form of the domain that lacks zn-binding site
  8. 1066036Domain d1akea2: 1ake A:122-156 [45185]
    Other proteins in same PDB: d1akea1, d1akeb1
    complexed with ap5

Details for d1akea2

PDB Entry: 1ake (more details), 2 Å

PDB Description: structure of the complex between adenylate kinase from escherichia coli and the inhibitor ap5a refined at 1.9 angstroms resolution: a model for a catalytic transition state
PDB Compounds: (A:) adenylate kinase

SCOPe Domain Sequences for d1akea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1akea2 g.41.2.1 (A:122-156) Microbial and mitochondrial ADK, insert "zinc finger" domain {Escherichia coli [TaxId: 562]}
grrvhapsgrvyhvkfnppkvegkddvtgeelttr

SCOPe Domain Coordinates for d1akea2:

Click to download the PDB-style file with coordinates for d1akea2.
(The format of our PDB-style files is described here.)

Timeline for d1akea2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1akea1