Lineage for d1e4vb2 (1e4v B:122-156)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2640990Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 2641006Superfamily g.41.2: Microbial and mitochondrial ADK, insert "zinc finger" domain [57774] (2 families) (S)
    automatically mapped to Pfam PF05191
  5. 2641007Family g.41.2.1: Microbial and mitochondrial ADK, insert "zinc finger" domain [57775] (1 protein)
  6. 2641008Protein Microbial and mitochondrial ADK, insert "zinc finger" domain [57776] (9 species)
  7. 2641032Species Escherichia coli [TaxId:562] [57778] (9 PDB entries)
    contains a rudiment form of the domain that lacks zn-binding site
  8. 2641041Domain d1e4vb2: 1e4v B:122-156 [45184]
    Other proteins in same PDB: d1e4va1, d1e4vb1
    complexed with ap5; mutant

Details for d1e4vb2

PDB Entry: 1e4v (more details), 1.85 Å

PDB Description: mutant g10v of adenylate kinase from e. coli, modified in the gly-loop
PDB Compounds: (B:) adenylate kinase

SCOPe Domain Sequences for d1e4vb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e4vb2 g.41.2.1 (B:122-156) Microbial and mitochondrial ADK, insert "zinc finger" domain {Escherichia coli [TaxId: 562]}
grrvhapsgrvyhvkfnppkvegkddvtgeelttr

SCOPe Domain Coordinates for d1e4vb2:

Click to download the PDB-style file with coordinates for d1e4vb2.
(The format of our PDB-style files is described here.)

Timeline for d1e4vb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1e4vb1