| Class g: Small proteins [56992] (54 folds) |
| Fold g.41: Rubredoxin-like [57769] (8 superfamilies) |
Superfamily g.41.2: Microbial and mitochondrial ADK, insert "zinc finger" domain [57774] (1 family) ![]() |
| Family g.41.2.1: Microbial and mitochondrial ADK, insert "zinc finger" domain [57775] (1 protein) |
| Protein Microbial and mitochondrial ADK, insert "zinc finger" domain [57776] (6 species) |
| Species Escherichia coli [TaxId:562] [57778] (6 PDB entries) |
| Domain d1e4va2: 1e4v A:122-156 [45183] Other proteins in same PDB: d1e4va1, d1e4vb1 |
PDB Entry: 1e4v (more details), 1.85 Å
SCOP Domain Sequences for d1e4va2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e4va2 g.41.2.1 (A:122-156) Microbial and mitochondrial ADK, insert "zinc finger" domain {Escherichia coli}
grrvhapsgrvyhvkfnppkvegkddvtgeelttr
Timeline for d1e4va2: