![]() | Class g: Small proteins [56992] (79 folds) |
![]() | Fold g.41: Rubredoxin-like [57769] (14 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
![]() | Superfamily g.41.2: Microbial and mitochondrial ADK, insert "zinc finger" domain [57774] (1 family) ![]() |
![]() | Family g.41.2.1: Microbial and mitochondrial ADK, insert "zinc finger" domain [57775] (1 protein) |
![]() | Protein Microbial and mitochondrial ADK, insert "zinc finger" domain [57776] (8 species) |
![]() | Species Escherichia coli [TaxId:562] [57778] (6 PDB entries) contains a rudiment form of the domain that lacks zn-binding site |
![]() | Domain d1e4yb2: 1e4y B:122-156 [45182] Other proteins in same PDB: d1e4ya1, d1e4yb1 complexed with ap5; mutant |
PDB Entry: 1e4y (more details), 1.85 Å
SCOP Domain Sequences for d1e4yb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e4yb2 g.41.2.1 (B:122-156) Microbial and mitochondrial ADK, insert "zinc finger" domain {Escherichia coli} grrvhapsgrvyhvkfnppkvegkddvtgeelttr
Timeline for d1e4yb2: