Lineage for d1e4yb2 (1e4y B:122-156)

  1. Root: SCOP 1.57
  2. 88227Class g: Small proteins [56992] (56 folds)
  3. 90495Fold g.41: Rubredoxin-like [57769] (9 superfamilies)
  4. 90504Superfamily g.41.2: Microbial and mitochondrial ADK, insert "zinc finger" domain [57774] (1 family) (S)
  5. 90505Family g.41.2.1: Microbial and mitochondrial ADK, insert "zinc finger" domain [57775] (1 protein)
  6. 90506Protein Microbial and mitochondrial ADK, insert "zinc finger" domain [57776] (6 species)
  7. 90523Species Escherichia coli [TaxId:562] [57778] (6 PDB entries)
  8. 90525Domain d1e4yb2: 1e4y B:122-156 [45182]
    Other proteins in same PDB: d1e4ya1, d1e4yb1

Details for d1e4yb2

PDB Entry: 1e4y (more details), 1.85 Å

PDB Description: mutant p9l of adenylate kinase from e. coli, modified in the gly-loop

SCOP Domain Sequences for d1e4yb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e4yb2 g.41.2.1 (B:122-156) Microbial and mitochondrial ADK, insert "zinc finger" domain {Escherichia coli}
grrvhapsgrvyhvkfnppkvegkddvtgeelttr

SCOP Domain Coordinates for d1e4yb2:

Click to download the PDB-style file with coordinates for d1e4yb2.
(The format of our PDB-style files is described here.)

Timeline for d1e4yb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1e4yb1