Lineage for d1e4ya2 (1e4y A:122-156)

  1. Root: SCOP 1.63
  2. 268577Class g: Small proteins [56992] (61 folds)
  3. 271305Fold g.41: Rubredoxin-like [57769] (10 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 271314Superfamily g.41.2: Microbial and mitochondrial ADK, insert "zinc finger" domain [57774] (1 family) (S)
  5. 271315Family g.41.2.1: Microbial and mitochondrial ADK, insert "zinc finger" domain [57775] (1 protein)
  6. 271316Protein Microbial and mitochondrial ADK, insert "zinc finger" domain [57776] (6 species)
  7. 271333Species Escherichia coli [TaxId:562] [57778] (6 PDB entries)
    contains a rudiment form of the domain that lacks zn-binding site
  8. 271334Domain d1e4ya2: 1e4y A:122-156 [45181]
    Other proteins in same PDB: d1e4ya1, d1e4yb1

Details for d1e4ya2

PDB Entry: 1e4y (more details), 1.85 Å

PDB Description: mutant p9l of adenylate kinase from e. coli, modified in the gly-loop

SCOP Domain Sequences for d1e4ya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e4ya2 g.41.2.1 (A:122-156) Microbial and mitochondrial ADK, insert "zinc finger" domain {Escherichia coli}
grrvhapsgrvyhvkfnppkvegkddvtgeelttr

SCOP Domain Coordinates for d1e4ya2:

Click to download the PDB-style file with coordinates for d1e4ya2.
(The format of our PDB-style files is described here.)

Timeline for d1e4ya2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1e4ya1