Lineage for d1zioa2 (1zio A:126-160)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 892941Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 892957Superfamily g.41.2: Microbial and mitochondrial ADK, insert "zinc finger" domain [57774] (1 family) (S)
  5. 892958Family g.41.2.1: Microbial and mitochondrial ADK, insert "zinc finger" domain [57775] (1 protein)
  6. 892959Protein Microbial and mitochondrial ADK, insert "zinc finger" domain [57776] (8 species)
  7. 892962Species Bacillus stearothermophilus [TaxId:1422] [57777] (3 PDB entries)
  8. 892965Domain d1zioa2: 1zio A:126-160 [45180]
    Other proteins in same PDB: d1zioa1
    complexed with ap5, mg, zn

Details for d1zioa2

PDB Entry: 1zio (more details), 1.96 Å

PDB Description: phosphotransferase
PDB Compounds: (A:) adenylate kinase

SCOP Domain Sequences for d1zioa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zioa2 g.41.2.1 (A:126-160) Microbial and mitochondrial ADK, insert "zinc finger" domain {Bacillus stearothermophilus [TaxId: 1422]}
grricrncgatyhlifhppakpgvcdkcggelyqr

SCOP Domain Coordinates for d1zioa2:

Click to download the PDB-style file with coordinates for d1zioa2.
(The format of our PDB-style files is described here.)

Timeline for d1zioa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zioa1