SCOP 1.71: Domain d1zio_2: 1zio 126-160

Lineage for d1zio_2 (1zio 126-160)

1. Root: SCOP 1.71

2. Class g: Small proteins [56992] (79 folds)

3. Fold g.41: Rubredoxin-like [57769] (14 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.2: Microbial and mitochondrial ADK, insert "zinc finger" domain [57774] (1 family)

5. Family g.41.2.1: Microbial and mitochondrial ADK, insert "zinc finger" domain [57775] (1 protein)

6. Protein Microbial and mitochondrial ADK, insert "zinc finger" domain [57776] (8 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [57777] (3 PDB entries)

8. Domain d1zio_2: 1zio 126-160 [45180]
   Other proteins in same PDB: d1zio_1
   complexed with ap5, mg, zn

Details for d1zio_2

PDB Entry: 1zio, 1.96 Å

PDB Description: phosphotransferase

SCOP Domain Sequences for d1zio_2:

Sequence; same for both SEQRES and ATOM records:

>d1zio_2 g.41.2.1 (126-160) Microbial and mitochondrial ADK, insert "zinc finger" domain {Bacillus stearothermophilus}
grricrncgatyhlifhppakpgvcdkcggelyqr

Timeline for d1zio_2:

• d1zio_2 first appeared (with stable ids) in SCOP 1.55
  
• d1zio_2 appears in SCOP 1.69
  
• d1zio_2 is called d1zioa2 in SCOP 1.73
  
• d1zio_2 appears in the current release, SCOPe 2.08, called d1zioa2