Lineage for d1zio_2 (1zio 126-160)
- Root: SCOP 1.61
Class g: Small proteins [56992] (59 folds) 
Fold g.41: Rubredoxin-like [57769] (9 superfamilies) 
Superfamily g.41.2: Microbial and mitochondrial ADK, insert "zinc finger" domain [57774] (1 family) 
Family g.41.2.1: Microbial and mitochondrial ADK, insert "zinc finger" domain [57775] (1 protein) Protein Microbial and mitochondrial ADK, insert "zinc finger" domain [57776] (6 species) Species Bacillus stearothermophilus [TaxId:1422] [57777] (3 PDB entries) 
Domain d1zio_2: 1zio 126-160 [45180]
Other proteins in same PDB: d1zio_1
Details for d1zio_2
PDB Entry: 1zio (more details), 1.96 Å
PDB Description: phosphotransferase
SCOP Domain Sequences for d1zio_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zio_2 g.41.2.1 (126-160) Microbial and mitochondrial ADK, insert "zinc finger" domain {Bacillus stearothermophilus}
grricrncgatyhlifhppakpgvcdkcggelyqr
SCOP Domain Coordinates for d1zio_2:
Click to download the PDB-style file with coordinates for d1zio_2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1zio_2:
- d1zio_2 first appeared (with stable ids) in SCOP 1.55
- d1zio_2 appears in SCOP 1.59
- d1zio_2 appears in SCOP 1.63
- d1zio_2 appears in the current release, SCOPe 2.08, called d1zioa2
View in 3D
