Lineage for d1zipa2 (1zip A:126-160)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2262912Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 2262928Superfamily g.41.2: Microbial and mitochondrial ADK, insert "zinc finger" domain [57774] (2 families) (S)
    automatically mapped to Pfam PF05191
  5. 2262929Family g.41.2.1: Microbial and mitochondrial ADK, insert "zinc finger" domain [57775] (1 protein)
  6. 2262930Protein Microbial and mitochondrial ADK, insert "zinc finger" domain [57776] (9 species)
  7. 2262933Species Bacillus stearothermophilus [TaxId:1422] [57777] (3 PDB entries)
  8. 2262935Domain d1zipa2: 1zip A:126-160 [45179]
    Other proteins in same PDB: d1zipa1
    complexed with ap5, mn, zn

Details for d1zipa2

PDB Entry: 1zip (more details), 1.85 Å

PDB Description: bacillus stearothermophilus adenylate kinase
PDB Compounds: (A:) adenylate kinase

SCOPe Domain Sequences for d1zipa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zipa2 g.41.2.1 (A:126-160) Microbial and mitochondrial ADK, insert "zinc finger" domain {Bacillus stearothermophilus [TaxId: 1422]}
grricrncgatyhlifhppakpgvcdkcggelyqr

SCOPe Domain Coordinates for d1zipa2:

Click to download the PDB-style file with coordinates for d1zipa2.
(The format of our PDB-style files is described here.)

Timeline for d1zipa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zipa1