![]() | Class g: Small proteins [56992] (79 folds) |
![]() | Fold g.41: Rubredoxin-like [57769] (14 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
![]() | Superfamily g.41.2: Microbial and mitochondrial ADK, insert "zinc finger" domain [57774] (1 family) ![]() |
![]() | Family g.41.2.1: Microbial and mitochondrial ADK, insert "zinc finger" domain [57775] (1 protein) |
![]() | Protein Microbial and mitochondrial ADK, insert "zinc finger" domain [57776] (8 species) |
![]() | Species Bacillus stearothermophilus [TaxId:1422] [57777] (3 PDB entries) |
![]() | Domain d1zip_2: 1zip 126-160 [45179] Other proteins in same PDB: d1zip_1 complexed with ap5, mn, zn |
PDB Entry: 1zip (more details), 1.85 Å
SCOP Domain Sequences for d1zip_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zip_2 g.41.2.1 (126-160) Microbial and mitochondrial ADK, insert "zinc finger" domain {Bacillus stearothermophilus} grricrncgatyhlifhppakpgvcdkcggelyqr
Timeline for d1zip_2: