Lineage for d1qqta3 (1qqt A:141-175)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 41508Fold g.41: Rubredoxin-like [57769] (8 superfamilies)
  4. 41509Superfamily g.41.1: Methionyl-tRNA synthetase (MetRS), Zn-domain [57770] (1 family) (S)
  5. 41510Family g.41.1.1: Methionyl-tRNA synthetase (MetRS), Zn-domain [57771] (1 protein)
  6. 41511Protein Methionyl-tRNA synthetase (MetRS), Zn-domain [57772] (1 species)
  7. 41512Species Escherichia coli [TaxId:562] [57773] (3 PDB entries)
  8. 41513Domain d1qqta3: 1qqt A:141-175 [45175]
    Other proteins in same PDB: d1qqta1, d1qqta2

Details for d1qqta3

PDB Entry: 1qqt (more details), 2.03 Å

PDB Description: methionyl-trna synthetase from escherichia coli

SCOP Domain Sequences for d1qqta3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qqta3 g.41.1.1 (A:141-175) Methionyl-tRNA synthetase (MetRS), Zn-domain {Escherichia coli}
vkgtcpkckspdqygdncevcgatyspteliepks

SCOP Domain Coordinates for d1qqta3:

Click to download the PDB-style file with coordinates for d1qqta3.
(The format of our PDB-style files is described here.)

Timeline for d1qqta3: