Lineage for d1dsva_ (1dsv A:)

  1. Root: SCOPe 2.08
  2. Class g: Small proteins [56992] (100 folds)
  3. Fold g.40: Retrovirus zinc finger-like domains [57755] (1 superfamily)
    metal(zinc)-bound fold
  4. Superfamily g.40.1: Retrovirus zinc finger-like domains [57756] (1 family) (S)
  5. Family g.40.1.1: Retrovirus zinc finger-like domains [57757] (6 proteins)
  6. Protein Nucleic acid binding protein p14 [57767] (1 species)
  7. Species Mouse mammary tumor virus [TaxId:11757] [57768] (2 PDB entries)
  8. Domain d1dsva_: 1dsv A: [45174]
    complexed with zn

Details for d1dsva_

PDB Entry: 1dsv (more details)

PDB Description: structure of the mmtv nucleocapsid protein (c-terminal zinc finger)
PDB Compounds: (A:) nucleic acid binding protein p14

SCOPe Domain Sequences for d1dsva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dsva_ g.40.1.1 (A:) Nucleic acid binding protein p14 {Mouse mammary tumor virus [TaxId: 11757]}
ppglcprckkgyhwkseckskfdkdgnplpp

SCOPe Domain Coordinates for d1dsva_ are not available.

Timeline for d1dsva_: