Lineage for d1a6bb_ (1a6b B:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3036238Fold g.40: Retrovirus zinc finger-like domains [57755] (1 superfamily)
    metal(zinc)-bound fold
  4. 3036239Superfamily g.40.1: Retrovirus zinc finger-like domains [57756] (1 family) (S)
  5. 3036240Family g.40.1.1: Retrovirus zinc finger-like domains [57757] (6 proteins)
  6. 3036268Protein Zinc finger protein ncp10 [57765] (3 species)
  7. 3036273Species Moloney murine leukemia virus, MoMLV [TaxId:11801] [57766] (2 PDB entries)
    Uniprot P03332 479-534
  8. 3036274Domain d1a6bb_: 1a6b B: [45172]
    contains a sequence of the psi-packaging domain of HIV-1
    protein/DNA complex; complexed with zn

Details for d1a6bb_

PDB Entry: 1a6b (more details)

PDB Description: nmr structure of the complex between the zinc finger protein ncp10 of moloney murine leukemia virus and a sequence of the psi-packaging domain of hiv-1, 20 structures
PDB Compounds: (B:) zinc finger protein ncp10

SCOPe Domain Sequences for d1a6bb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a6bb_ g.40.1.1 (B:) Zinc finger protein ncp10 {Moloney murine leukemia virus, MoMLV [TaxId: 11801]}
gerrrsqldrdqcayckekghwakdcpkkprgprgprpqt

SCOPe Domain Coordinates for d1a6bb_:

Click to download the PDB-style file with coordinates for d1a6bb_.
(The format of our PDB-style files is described here.)

Timeline for d1a6bb_: