Class g: Small proteins [56992] (100 folds) |
Fold g.40: Retrovirus zinc finger-like domains [57755] (1 superfamily) metal(zinc)-bound fold |
Superfamily g.40.1: Retrovirus zinc finger-like domains [57756] (1 family) |
Family g.40.1.1: Retrovirus zinc finger-like domains [57757] (6 proteins) |
Protein Zinc finger protein ncp10 [57765] (3 species) |
Species Moloney murine leukemia virus, MoMLV [TaxId:11801] [57766] (2 PDB entries) Uniprot P03332 479-534 |
Domain d1a6bb_: 1a6b B: [45172] contains a sequence of the psi-packaging domain of HIV-1 protein/DNA complex; complexed with zn |
PDB Entry: 1a6b (more details)
SCOPe Domain Sequences for d1a6bb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a6bb_ g.40.1.1 (B:) Zinc finger protein ncp10 {Moloney murine leukemia virus, MoMLV [TaxId: 11801]} gerrrsqldrdqcayckekghwakdcpkkprgprgprpqt
Timeline for d1a6bb_: